PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 190aa    MW: 21868.3 Da    PI: 5.1088
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-34431PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-17243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T++E+ ++++++ ++G++ W++Iar+++ gRt++++k++w++++
        Lsa006911  2 TPQEERRILELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.599147IPR017930Myb domain
SMARTSM007171.6E-11145IPR001005SANT/Myb domain
CDDcd001676.46E-12143No hitNo description
SuperFamilySSF466899.36E-13248IPR009057Homeodomain-like
PfamPF002496.0E-15242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-20244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MTPQEERRIL ELHSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQEQ KRALSPSSSL  60
SDSSSYSSIY TSNHTVHSMP MMETKEKSFY DTGGLEMLTI TKGESNSNTI TSIATSLNNS  120
SEGEDGYNSM DEIWKNIDLL EDDGIRPIFD TSNEITPSPI WDYSLNTLWM IDGQEEIGSN  180
MFFPDNKRAI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651059.14e-48PREDICTED: transcription factor MYB59
TrEMBLA0A103XPL81e-81A0A103XPL8_CYNCS; Homeodomain-like protein
STRINGVIT_06s0004g04140.t019e-48(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-38myb domain protein 48